Greener Solvents
Greener Solvents
N-butylpyrrolidinone (NBP; TamiSolve NxG-PS) has demonstrated the ability to work well as a greener alternative apolar diprotic solvent. It’s use in microwave SPPS is easier than traditional methods since the elevated temperature reduces its relatively high viscosity.

Additionally, CEM has developed a unique solvent mixture that is ideal for microwave peptide synthesis1. This is based on the use of anisole and N-butylpyrrolidinone that provides ideal properties for completely replacing traditional solvents. This solvent system has been demonstrated on a range of difficult peptides and provides favorable toxicity, reduced viscosity, and low overall cost.

Learn More

View Data

CEM’s Unique Microwave SPPS Technology

Synthesis of a 75mer Peptide free of any CMR Solvent

VVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAWMAKEFGIPAAVAGTVLNHVKKK-NH2

CEM’s Unique Microwave SPPS Technology

1US 11,014,959; WO2019241586A1